PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v3892210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 206aa    MW: 23400.8 Da    PI: 9.0746
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v3892210.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM83.44.4e-26211481128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k..kvkaeekewyfFskrdkkyatgkrknratksgyWk..atgkd 89 
                      l pG++F+ tde lv++yLk+++ g++l++ ++i++++++++ePw Lp    ++  +e++++f+ +  +    ++   r + sg W+  ++gkd
  Lj1g3v3892210.1  21 LLPGYKFDATDEVLVDFYLKRRAFGQPLPI-QIIPDFNVFQTEPWGLPgGdgRI-FNERKCFFYNTMGRDL--ESLDMRDAGSGQWRvvEKGKD 110
                      579***************************.89***************534332.3678999999988876..46889999******4455666 PP

              NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++ + +++++g ++tL+f++ +   +++t+Wvmhe+rl
  Lj1g3v3892210.1 111 IPIPR-NNQVIGKRNTLIFWEVQGACARRTKWVMHEFRL 148
                      66666.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-3218168IPR003441NAC domain
PROSITE profilePS5100534.16221168IPR003441NAC domain
PfamPF023656.8E-1423148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MTSFEMEVGL ITYDKDGSAR LLPGYKFDAT DEVLVDFYLK RRAFGQPLPI QIIPDFNVFQ  60
TEPWGLPGGD GRIFNERKCF FYNTMGRDLE SLDMRDAGSG QWRVVEKGKD IPIPRNNQVI  120
GKRNTLIFWE VQGACARRTK WVMHEFRLVL IANPSKMGNW IVYRIFLKKD AKSIRGSNGE  180
STKGGRIAGS VEVIDLNEGS DSFLGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-22141708170Stress-induced transcription factor NAC1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0096341e-144AP009634.1 Lotus japonicus genomic DNA, clone: LjB16I02, BM1852, complete sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF134131127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.12e-32NAC domain containing protein 83